Monday, September 9, 2013

EI sir ;Molecular biology


                                    What is gene expression?
Gene expression is the process by which information from a gene is used in the synthesis of a functional gene product. These products are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is a functional RNA
Ø      Biological processes, such as transcription, and in case of proteins, also translation, that yield a gene product.
Ø      A gene is expressed when its biological product is present and active.
Ø      Gene expression is regulated at multiple levels.

Regulation of Gene Expression in Eukaryotes
Gene expression occurs in two major stages -
The first is transcription. In this process, the gene is copied to produce an RNA molecule (a primary transcript). Most human genes are divided into exons and introns, and only the exons carry information required for protein synthesis. Most primary transcripts are therefore processed by splicing to remove intron sequences and generate a mature transcript or messenger RNA (mRNA) that only contains exons.

The second stage
is protein synthesis. This stage is also known as translation.
        Virtually every cell in your body contains a complete set of genes
        But they are not all turned on in every tissue
        Each cell in your body expresses only a small subset of genes at any time
        During development different cells express different sets of genes in a precisely regulated fashion
        Constitutive ( house keeping) genes:
         - Are expressed at a fixed rate, irrespective to the cell condition.
         - Their structure is simpler

Controllable genes:
         - Are expressed only as needed. Their amount may increase or decrease with respect to their basal level in different condition.
         - Their structure is relatively complicated with some response elements

Levels of Control of Gene Expression in Eukaryotes
Eukaryotes have more complex means to regulate gene expression, because they have compartments (e.g., nucleus) within cells, and often multicellular structures that require differentiation of cells.
Levels at which expression of protein-coding genes is regulated in eukaryotes
    1. Transcription.
    2. mRNA processing and transport.
    3. Translation.
    4. Degradation of mRNA.
    5. Protein processing.
                 f.     Protein degradation.


                                  

TS mam Bioinformatics Introduction


                                                
                                                What is Bioinformatics?
Application of computational tools on molecular data, including the means to acquire, analyze, or visualize such data.

Bioinformatics is a relatively new interdisciplinary field that integrates computer science, mathematics, biology, and information technology to manage, analyze, and understand biological, biochemical and biophysical information.

Bioinformatics is the development of computational methods for studying structure, function and evolution of genes, proteins and whole genomes.


                                                                                                                                                                                                               
Molecular Bioinformatics
Molecular Bioinformatics involves the use of computational tools to discover new information in complex data sets (from the one-dimensional information of DNA through the two-dimensional information of RNA and the three-dimensional information of proteins, to the four-dimensional information of evolving living systems).

                           


                             
                                   
                                    Origin of bioinformatics and biological databases:

The first protein sequence reported was that of bovine insulin in 1956, consisting of 51 residue
(Amino Acids).
Nearly a decade later, the first nucleic acid sequence was reported, that of yeast tRNA alanine with 77 bases.

In 1965, Dayhoff gathered all the available sequence data to create the first bioinformatic database (Atlas of Protein Sequence and Structure).
The Protein DataBank followed in 1972 with a collection of ten X-ray crystallographic protein structures.The SWISSPROT protein sequence database began in 1987.




                              

                                                                       

Some Terminology
Cell is a primary unit of life
• Cell consists of molecules, chemical reactions and a copy of the genome for that organism
• All life on this planet depends on three types of molecules: DNA, RNA and proteins

• DNA
– Holds information on how cell works

• RNA
– Acts to transfer short pieces of information to different parts of cell
– Provide templates to synthesize into protein

• Proteins
– Form enzymes that send signals to other cells and regulate gene activity
– Form body’s major components (e.g. hair, skin, etc.)


                                                           
DNA - Deoxyribonucleic Acid
• Genetic material
• Consists of two long strands

• Each strand is made of:
– Phosphates
– Sugar
– Nucleotides
• A (adenine)
• G (guanine)
• C (cytosine)
• T (thymine)

.


                                               
                                               
The Central Dogma of Molecular Biology
                                   

• Information has been transferred from DNA (information storage molecule) to RNA (information transfer molecule) to a specific protein (a functional, non-coding product)
                                       
                                                                       




                                                               
                                                              
More Terminology
• Transcription of DNA

– DNA transcribed into RNA
– RNA exits as a single-strand unit and as a double- helix as well
– RNA consist of A, C, G and U (uracil)
• Types of RNA
– Messenger RNA – mRNA
 – Transfer RNA – tRNA
– Ribosomal RNA – rRNA

• Translation of Messenger RNA (mRNA):
– mRNA is translated into protein
 
• Proteins:
– linear polymers built from amino acids

 • The transfer of information from DNA to specific protein via RNA takes place according to the genetic code.
– The RNA sequence is divided into blocks of three letters
– This block is called CODON
– Each codon corresponds to the specific amino acid

• Four different nucleotides are used to build DNA and RNA molecules – A, G, C, T and A, G, C, U
• 20 different amino acids are used in protein synthesis
• Four nucleotides can be arranged in 64 different combinations of three.
• There are 64 = 4*4*4 different codons
• Some codons are redundant and some have special function to terminate the translation process

                                                   
Why is bioinformatics important?
• Traditionally, research was carried out entirely at the experimental laboratory but the huge increase in the data in the genomic era has seen a need to incorporate computers into this research process.

• There are three central biological processes around which bioinformatics tools must be developed:
-DNA sequence determines protein sequence
-Protein sequence determines protein structure
-Protein structure determines protein function

                                                           
      Major research areas
Sequence analysis-A comparison of genes within a species or between different species can show similarities between protein functions.
 
• The comparison of sequences in order to find similar and dissimilar in compared sequences (sequence alignment)

• Identification of gene-structures, reading frames, distributions of introns and exons and regulatory elements

• Revealing the evolution and genetic diversity of organisms.

                                               
                                      Computational evolutionary biology-
• Evolutionary biology is the study of the origin and descent of species, as well as their change over time.  Informatics has assisted evolutionary biologists in several key ways;
it has enabled researchers to:

-trace the evolution of a large number of organisms by measuring changes in their DNA, rather than through physical taxonomy or physiological observations alone,
-build complex computational models of populations to predict the outcome of the system over time,
-and track and share information on an increasingly large number of species and organisms.

Prediction of protein structure-

Protein structure prediction is another important application of bioinformatics.

• In the genomic branch of bioinformatics, homology is used to predict the function of a gene: if the sequence of gene A, whose function is known, is homologous to the sequence of gene B, whose function is unknown, one could infer that B may share A's function.

• MODELLER is one of the best software for Homology modelling. Protein Data Bank is the data base for 3D co- ordinates of a protein.

Drug Designing- Drug design is the approach of finding drugs by design, based on their biological targets.

Computer-assisted drug design uses computational chemistry to discover, enhance, or study drugs and related biologically active molecules.

Phylogenetics- Predicting the genetic or evolutionary relation of set of organisms. Mitochondrial SNPs and Microsatellites (DNA repeats) are mostly used in Phylogenetics. MEGA, PAUP are PAUP* are some of the important software's. Maximum Parsimony and Maximum Likelyhood are mostly used methods.


                                      

Bioinformatics -TS mam





Concepts of Bioinformatics


1.  Introduction

Bioinformatics  is  the  field  of  science  in  which  biology,  computer  science,  and information technology merge to form a single discipline. It is the emerging field that deals  with  the  application  of  computers  to  the  collection,  organization,  analysis, manipulation, presentation, and sharing of biologic data to solve biological problems on the molecular level. According to Frank Tekaia, bioinformatics is the mathematical, statistical and computing methods that aim to solve biological problems using DNA and amino acid sequences and related information.




















Fig 1. Concepts of Bioinformatics


The term bioinformatics  was coined by Paulien Hogeweg in  1979 for the study of
informatic  processes  in  biotic  systems.
 The  National  Center  for  Biotechnology
Information (NCBI, 2001)   defines   bioinformatics   as:   "Bioinformatics   is   the   field   of
science  in  which  biology,  computer  science,  and  information  technology merge  into  a single  discipline.  There  are  three  important  sub-disciplines  within  bioinformatics:  the development of new algorithms and statistics   with   which   to   assess   relationships   among members   of   large   data   sets;   the   analysis   and interpretation of various types of data including nucleotide and amino acid sequences, protein domains, and protein structures; and  the  development  and  implementation  of  tools  that  enable  efficient  access  and management of different types of information.”







Concepts of Bioinformatics



Bioinformatics is a scientific discipline that has emerged in response to accelerating demand for a
flexible and intelligent means of storing, managing and querying large and complex biological data
sets. The ultimate aim of bioinformatics is to enable the discovery of new biological insights as well
as to create a global perspective from which unifying principles in biology can be discerned. Over
the past few decades rapid developments in genomic and other molecular research technologies and
developments in information technologies have combined to produce a tremendous amount  of
information related to molecular biology. At the beginning of the genomic revolution, the   main
concern  of  bioinformatics  was   the  creation   and   maintenance  of  a  database  to   store  biological
information  such as nucleotide and amino acid sequences. Development of this type of database
involved not only design issues but the development of an interface whereby researchers could both
access   existing  data   as   well   as  submit   new  or   revised   data
(e.g.   to   the   NCBI,
http://www.ncbi.nlm.nih.gov/). More recently, emphasis has shifted towards the analysis of large
data sets, particularly those stored in different formats in different databases. Ultimately, all of this information must be combined to form a comprehensive picture of normal cellular activities so that researchers may study how these activities are altered in different disease states. Therefore, the field of bioinformatics has   evolved such that the most pressing task now involves the analysis   and interpretation   of various types of data, including nucleotide and amino acid sequences, protein domains, and protein structures.
2.  Origin & History of Bioinformatics

Over a century ago, bioinformatics history started with an Austrian monk named Gregor Mendel. He
is known as the ―Father of Genetics". He cross-fertilized different colors of the same species of
flowers. He kept careful records of the colors of flowers that he cross-fertilized and the color(s) of
flowers they produced.   Mendel   illustrated   that   the   inheritance   of   traits   could   be   more   easily
explained if it was controlled by factors passed down from generation to generation.
After this discovery of Mendel, bioinformatics and genetic record keeping have come a long way.
The understanding of  genetics  has advanced remarkably in  the  last  thirty years.  In 1972,  Paul
Berg made the first recombinant DNA molecule using ligase. In that same year, Stanley Cohen, Annie Chang and Herbert Boyer produced the first recombinant DNA organism.   In 1973, two important things happened in the field of genomics:

1.   Joseph Sambrook led a team that refined DNA electrophoresis using agarose gel, and
2.   Herbert Boyer and Stanely Cohen invented DNA cloning. By 1977, a method for sequencing
      DNA was discovered and the first genetic engineering company, Genetech was founded.

During  1981,  579 human genes  had  been  mapped and  mapping  by in situ  hybridization  had
become a standard method. Marvin Carruthers and Leory Hood made a huge leap in bioinformatics
when they invented  a  method  for  automated DNA  sequencing.  In 1988,  the  Human  Genome
Organization (HUGO) was founded. This is an international organization of scientists involved in
Human Genome Project.   In 1989,   the   first   complete   genome   map   was   published   of   the
bacteria  Haemophilus influenza .




TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
334






Concepts of Bioinformatics

The following year, the Human Genome Project was started. In 1991, a total of 1879 human genes had  been mapped.   In  1993,  Genethon,  a  human  genome  research  center  in  France  produced roduced  a physical map of the human genome. Three years later, Genethon published the final version  of the Human Genetic Map which concluded the end of the first phase of the Human Genome Project.
Bioinformatics was fuelled by the need to create huge databases, such as GenBank and EMBL and DNA Database of Japan to store and compare the DNA sequence data erupting from the human genome and other genome sequencing projects. Today, bioinformatics embraces protein structure analysis, gene and protein functional information, data from patients, pre-clinical and clinical trials, and the metabolic pathways of numerous species.

3.  Importance

The greatest challenge facing the molecular biology community today is to make sense of the wealth of data that has been produced by the genome sequencing projects. Cells have a central core called nucleus, which is storehouse of an important molecule known as DNA. They are packaged in units known as chromosomes. They are together known as the genome.   Genes are specific regions of the genomes  (about  1%)  spread  throughout  the  genome,  sometimes  contiguous,  many times  noncontiguous. RNAs similarly contains informations, their major purpose is to copy information from DNA selectively and to bring it out of the nucleus for its use. Proteins are made of amino acids, which are twenty in count (researchers are debating on increasing this count, as couple of new ones are claimed to be identified).

The gene regions of the DNA in the nucleus of the cell is copied (transcribed) into the RNA and RNA
travels to protein production sites and is translated into proteins is the Central Dogma of Molecular
Biology. Portions of DNA Sequence are transcribed into RNA. The first step of a cell is to copy a
particular portion of its DNA nucleotide sequence (i.e. gene) which is shown in Fig 2 and Fig 3.































TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
335






Concepts of Bioinformatics


















Fig 2. Biological Systems
Bioinformatics,   being   an   interface   between   modern   biology   and   informatics   it   involves
discovery,  development and implementation of computational algorithms and software tools that
facilitate an understanding of the biological processes  (Fig 3.) with the goal to serve primarily
agriculture  and  healthcare  sectors  with  several  spinoffs.  In  a  developing  country  like  India,
bioinformatics has a key role to play in areas like agriculture where it can be used for increasing
the nutritional content, increasing the volume of the agricultural produce and implanting disease
resistance etc. In the pharmaceutical sector, it can be used to reduce the time and cost involved in
drug discovery process particularly for third world diseases, to custom design drugs and to develop
personalized medicine.


















Fig 3. Biological Processes

TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
336






Concepts of Bioinformatics



















Fig 4. Information on Sequence Data

Traditionally, molecular biology research was carried out entirely at the experimental laboratory
bench but the huge increase in the scale of data being produced in this genomic era has seen a need
to incorporate computers into this research process. Sequence generation, its subsequent storage,
interpretation and analysis are entirely computer dependent tasks. However, the molecular biology of
an organism is a very complex issue with research being carried out at molecular level. The first
challenge facing the bioinformatics community today is the intelligent and efficient storage of this
massive data. Moreover, it is essential to provide easy and reliable access to this data. The data itself
is meaningless before analysis and it is impossible for even a trained biologist to begin to interpret it
manually.   Therefore,    automated   computer   tools   must   be   developed   to   allow   the   extraction
of meaningful   biological   information.   There are three central biological processes around which
bioinformatics tools must be developed:
  DNA sequence which determines protein sequence
  Protein sequence which determines protein structure
  Protein structure which determines protein function
















TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
337






Concepts of Bioinformatics










































Fig. 5. Hypothesis-generating bioinformatics








TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
338







Concepts of Bioinformatics
4.  Difference between Bioinformatics and Computational Biology
Both  Bioinformatics  and  Computational  Biology  are  Computers  and  Biology.  Biologists  who
specialize  in  use  of  computational  tools  and  systems  to  answer  problems  of  biology  are
bioinformaticians. Computer scientists, mathematicians, statisticians, and engineers who specialize in
developing  theories,  algorithms  and  techniques  for  such  tools  and  systems  are  computational
biologists.   The actual process of analyzing and interpreting data is referred to as computational
biology. Important sub- disciplines within bioinformatics and computational biology include:

 the development and implementation of tools that enable efficient access to, and use and
    
management of, various types of information.
 the  development  of  new  algorithms  (mathematical  formulas)  and  statistics  with  which  to
    
assess   relationships   among members of large data sets, such as methods to locate a gene
    
within a sequence,   predict   protein structure and/or function, and cluster protein sequences
     into families of related sequences

Bioinformatics   has   become   a   mainstay   of   genomics,   proteomics,   and   all   other *.omics   (such   as
phenomics) and many information technology companies have entered the business or are considering entering the business, creating an IT (information technology) and BT (biotechnology) convergence. A bioinformaticist is an expert who not only knows how to use bioinformatics tools, but also knows how to write interfaces for effective use of the tools. A bioinformatician, on the other hand, is a trained individual who only knows to use bioinformatics tools without a deeper understanding.
5.       Biological databases
Biological databases are huge data bases of mostly sequence data pouring in from many genome sequencing projects going on all over the world. They are an important tool in assisting scientists to understand and explain a host of biological phenomena from the structure of biomolecules and their interaction, to the whole metabolism of organisms to understanding the evolution of species. This knowledge helps facilitate to fight against diseases, assists in the development of medications and in discovering basic relationships amongst species in the history of life.

The  information  about  DNA,  proteins  and  the  function  of  proteins  must  be  stored  in  an
intelligent fashion,  so  that  scientists  can solve  problems  quickly and easily  using  all available
information. Therefore, the information is stored in databanks, many of which are accessible to
everyone on the internet. A few examples are a databank containing protein structures (the PDB or
Protein Data Bank), a databank containing protein sequences   and their function  (Swiss-Prot), a
databank with information about enzymes and their function  (ENZYME), and a   databank with
nucleotide   sequences   of   all   genes   sequenced   up   to   date (EMBL).   Due to the current state of
technology, there are large differences between the sizes of databanks. EMBL, the nucleotides
database contains many more sequences than the number of protein structures registered in the PDB.
The reason for this is that it is a lot simpler to sequence a gene, than to find out which protein is
encoded by this gene and what its function is. Also it is more difficult to determine the structure of
the protein.

Using  databanks,   one   can   perform   all   kinds   of   comparisons   and   search   queries.   If, for
example, you know a protein which causes a disease in humans, your might look into a databank to

TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
339







Concepts of Bioinformatics


see if a similar protein has previously been described and what this protein does in the human body.
Using known information will make it easier and quicker to develop a drug against the disease or a test to detect the disorder in an early stage.
The Biological data can be broadly classified as:
Biological Databases                                               Information they contain
1. Bibliographic databases                                         Literature
2. Taxonomic databases                                            Classification
3. Nucleic acid databases                                          DNA information
4. Genomic databases                                                Gene level information
5. Protein databases                                                  Protein information
6. Protein families, domains and functional sites  Classification of proteins and identifying
domains
7. Enzymes/ metabolic pathways                                Metabolic pathways

There are many different types of database but for routine sequence analysis, the following are initially the most important
1.   Primary databases:  Contain sequence data such as nucleic acid or protein.  Example of
     
primary databases include:

Protein Databases                      Nucleic Acid Databases
• SWISS-PROT                           • EMBL
• TREMBL                                   • Genbank
• PIR                                            • DDBJ
2.   Secondary databases: These are also known as pattern databases contain results from                 the
analysis of the sequences in the primary databases. Example of secondary databases include: PROSITE, Pfam, BLOCKS, PRINTS.

6.  Introduction to NCBI and Entrez
The web-site of National Center for Biotechnology Information (NCBI) is one of the world's premier
website for biomedical and bioinformatics research  (http://www.ncbi.nlm.nih.gov/). Based within
the National Library of Medicine at the National Institutes of Health, USA, the NCBI hosts many
databases used by biomedical and research professionals.    The     services include PubMed  (the
bibliographic database); GenBank  (the nucleotide sequence database); and the BLAST algorithm
for sequence comparison, among many others.  It is established in  1988 as a national resource
for  molecular  biology  information.  NCBI  creates  public  databases,  conducts  research  in
computational  biology,  develops  software  tools  for  analyzing  genome  data,  and  disseminates
biomedical information all  for the better understanding of molecular processes affecting human
health and disease.





TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
340






Concepts of Bioinformatics
Every database has a unique identifier. Each entry in a database must have a unique identifier EMBL Identifier (ID), GENBANK Accession Number (AC). This database stores information along with the sequence. Each piece of information is written on it's own line, with a code defining the line. For example, DE  (description); OS  (organism species); AC  (accession number). Relevant biological information is usually described in the feature table (FT).






















Fig 6. International Sequence Database Collaboration


7.  The Entrez Search and Retrieval System

Entrez is the text-based search and retrieval system used at NCBI for all of the major databases, including PubMed,   Nucleotide   and   Protein   Sequences,   Protein   Structures,   Complete   Genomes, Taxonomy, OMIM, and many others. Entrez is at once an indexing and retrieval system, a collection of data from many sources, and an organizing principle for biomedical information. These general concepts are the focus of this section (Fig 7.).















TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
341






Concepts of Bioinformatics






















Fig 7. NCBI - RDBMS

8.  The Nucleotide Sequence database
The   GenBank   sequence   database   is   an   annotated   collection   of   all   publicly    available
nucleotide sequences and their protein translations. This database is produced at National Center for
Biotechnology Information  (NCBI)  as part of  an international collaboration with the  European
Molecular  Biology  Laboratory  (EMBL)  as  given  in  Fig. 8,  data  library  from  the  European
Bioinformatics Institute (EBI) and the DNA Data Bank of Japan (DDBJ) given in Fig. 9. GenBank
and its collaborators receive sequences produced in laboratories throughout the world from more
than  100,000 distinct organisms. GenBank continues  to  grow  at  an  exponential  rate,  doubling
every  10 months. Release 134, produced in February 2003,   and   contained   over 29.3   billion
nucleotide   bases   in   more   than      23.0   million sequences. GenBank is built by direct submissions
from individual laboratories, as well as from bulk submissions from large-scale sequencing centers.


















TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
342






Concepts of Bioinformatics























Fig. 8 EMBL Nucleotide Sequence Database





















Fig. 9. DNA Data Bank of Japan




TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
343







Concepts of Bioinformatics


9.  The Bibliographic Database
PubMed is a database developed by the NCBI. The  database  was  designed  to  provide  access  to
citations (with   abstracts)   from biomedical journals. Subsequently, a linking feature was added to
provide access to full-text journal articles at Web sites of participating publishers, as well as to other
related Web resources. PubMed is the bibliographic component of the NCBI's Entrez retrieval
system.
MEDLINE   is   NLM's   premier   bibliographic   database   covering   the   fields   of   medicine, nursing, dentistry, veterinary medicine, and the preclinical sciences. Journal articles are indexed for MEDLINE, and their citations are searchable, using NLM's controlled vocabulary, MeSH (Medical Subject Headings). MEDLINE contains all citations published in Index Medicus, and corresponds in part to the International Nursing Index and the Index to Dental Literature.

10.  Macromolecular Structure Databases
The resources provided by NCBI for studying   the   three-dimensional            (3D)   structures   of proteins
center around two databases: the Molecular Modeling Database (MMDB), which provides structural
information about individual proteins; and the Conserved Domain Database (CDD), which provides
a   directory   of   sequence   and   structure   alignments   representing   conserved   functional domains
within  proteins(CDs).  Together,  these  two  databases  allow  scientists  to  retrieve  and  view
structures, find structurally similar proteins to a protein of interest, and identify conserved functional
sites.
11.  Computer Programming in Bioinformatics: JAVA in Bioinformatics
The geographical scattered research centres all around the globe ranging from private to academic
settings, and a range of hardware and OSs are being used, Java is emerging as a key player in
bioinformatics. Physiome    Sciences'    computer-based    biological    simulation    technologies    and
Bioinformatics Solutions' PatternHunter are two examples of the  growing adoption of Java in
bioinformatics.
12.  Perl in Bioinformatics

String manipulation, regular expression matching, file parsing, data format interconversion etc are
the common text-processing tasks performed in bioinformatics. Perl excels in such tasks and is being
used by many developers. Yet, there are no standard modules designed in Perl specifically for the
field of bioinformatics. However, developers normally designed several of their own individual
modules for any specific purpose, which have become quite popular and are coordinated by the
BioPerl project.










TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
344






Concepts of Bioinformatics
13.  Measuring biodiversity
Biodiversity Databases are used to collect the species names, descriptions, distributions, genetic
information, status & size of populations, habitat needs, and how each organism interacts with
other species etc. Computer simulations models are useful to study population dynamics, or calculate
the cumulative   genetic   health   of   a    breeding   pool (in   agriculture)   or   endangered   population
(in conservation). Entire DNA sequences or genomes of endangered species can be preserved, allowing the results of Nature's genetic experiment to be remembered in silico.
In these days of growing human population and habitat destruction, knowledge of centers of high
biodiversity is critical for rational conservation decisions to be made. The major problem area is that
this information is largely unavailable to the decision makers.   It is ironic that most of these data
are in the great museums, which are located in the cool temperate parts of the world whereas; most
of the organisms are in the warm humid parts of the world.   The data that exist are paper based.
Descriptions by collectors and curators, herbarium sheets, diagrams and photographs, and of course,
pickled and preserved specimens with their labels. If a researcher wishes to consult these data he/she
has to travel to the museum in question. For people who need a breadth of information to make
decisions, this is obviously not an option. There are two areas in biology where enormous amounts
of information are generated. One is in molecular biology which deals with base sequences   in
DNA   and   amino   acid   sequences   in   proteins,   and   the   other   is   the   biodiversity information
crisis.   Mathematics   and   computers   are   being   used   to   tackle   these   problems   with procedures
which come under the label of Bioinformatics.























Fig 10. Biodiversity Hotspots regions




TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
345






Concepts of Bioinformatics


14.  Sequence analysis and alignment
The most well-known application of bioinformatics is sequence analysis.  In sequence analysis,  DNA
sequences  of  various  organisms   are  stored  in  databases  for  easy  retrieval   and comparison.   The
well-reported    Human    Genome    Project (Fig. 11)  is    an    example    of    sequence    analysis
bioinformatics. Using massive computers and various methods of collecting sequences, the entire human genome was sequenced and stored within a structured database. DNA sequences used for bioinformatics can be collected in a number of ways. One method is to go through a genome and search out individual sequences to record and store. Another method is to compare all fragments for finding whole sequences by overlapping the redundant segments. The latter method, known as shotgun sequencing, is currently the most popular because of its ease and speed.   By comparing known sequences of a genome to specific mutations, much information can be assembled about undesirable  mutations  such  as  cancers.  With  the  completed  mapping  of  the  human  genome, bioinformatics has become very important in the research of cancers in the hope of an eventual cure. Computers are also used to collect and store broader data about species. The Species 2000 project, for example, aims to collect a large amount of information about every species of plant, fungus, and animal on the earth. This information can then be used for a number of applications, including tracking changes in populations and biomes.




















Fig. 11. Human Genome Project
With the growing amount of data, earlier it was impractical to analyze DNA sequences manually. Nowadays, many tools and techniques are available provide the sequence comparisons (sequence alignment) and analyze the alignment product to understand the biology. For example, BLAST is used to search the genomes of thousands of organisms, containing billions of nucleotides. BLAST is software which can do this using dynamic programming, as fast  as  google searches  for  your keywords, considering the length of query words of bio-sequences.
TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
346







Concepts of Bioinformatics



Sequence Alignment: The sequence alignment can be categorized into two groups i.e. global and local alignment

Global Alignment
Input: two sequences S1, S2  over the same alphabet Output: two sequences S1, S2  of equal length
(S1, S2  are S1, S2  with possibly additional gaps)
Example:
u   S1= GCGCATGGATTGAGCGA
u
  S2= TGCGCCATTGATGACC
u   A possible alignment:
S1= -GCGC-ATGGATTGAGCGA
S2= TGCGCCATTGAT-GACC—
Local Alignment
Goal: Find the pair of substrings in two input sequences which have the highest similarity Input: two sequences S1, S2  over the same alphabet
Output: two sequences S 1, S 2  of equal length
(S1, S2 are substrings of S1, S2  with possibly additional gaps)
Example:
u   S1= GCGCATGGATTGAGCGA
u   S2= TGCGCCATTGATGACC
u   A possible alignment:
S1= ATTGA-G
S2= ATTGATG
FASTA: In bioinformatics, FASTA format is a text-based format for representing either nucleotide
sequences or peptide sequences, in which base pairs or amino acids are represented using single-
letter codes. The format also allows for sequence names and comments to precede the sequences.
The FASTA format may be used to represent either single sequences or many sequences in a single
file. A series of single sequences, concatenated, constitute a multisequence file. A sequence in
FASTA format is represented as a series of lines, which should be no longer than 120 characters and
usually do not exceed 80 characters. This probably was because to allow for preallocation of fixed
line sizes in software: at the time, most users relied on DEC VT (or compatible) terminals which
could display 80 or 132 characters per line. Most people would prefer normally the bigger font in 80-
character modes and so it became the recommended fashion to use 80 characters or less (often 70) in
FASTA lines. The first line in a FASTA file starts either with a ">" (greater-than) symbol or a ";"
(semicolon) and was taken as a comment. Subsequent lines starting with a semicolon would be
ignored by software. Since the only comment used was the first, it quickly became used to hold a
summary description of the sequence, often starting with a unique library accession number, and
with time  it has become commonplace use to always use ">" for the first line and to not use ";"
comments (which would otherwise be ignored).
>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]



TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
347






Concepts of Bioinformatics


LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSA IPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDS DKIPFHPYYTIKDFLGLLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWFLFAYAI LRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQP VEYPYTIIGQMASILYFSIILAFLPIAGXIENY
15.  Prediction of protein structure

Proteins play crucial functional roles in all biological processes:    enzymatic  catalysis, signaling
messengers, structural elements. Function depends on unique  3-D structure. It is easy to obtain
protein  sequences  but  difficult  to  determine  structure.  Protein  structure  prediction  is  another
important application of bioinformatics. The amino acid sequence of a protein, the so-called primary
structure, can be easily determined from the sequence on the gene that codes for it. In the vast
majority of cases, this primary structure uniquely determines a structure in its native environment.
Knowledge of this structure is vital in understanding the function of the protein. For lack of better
terms, structural information is usually classified as one of
secondary, tertiary and quaternary
structure. Protein structure prediction is the prediction of the three-dimensional structure of a protein
from its amino acid sequence i.e, the prediction of its tertiary structure from its primary structure.
Protein structures are being determined with increasing speed. Consequently, automated and fast
bioinformatics tools are required for exploring structure-function relationships in large numbers of
proteins. These are necessary both when the function has been characterized experimentally and
when it must be predicted.















Fig. 12. Protein Structure Prediction
In the genomic branch of bioinformatics, homology is used to predict the function of a gene: if the
sequence of gene A, whose function is known, is homologous to the sequence of gene B, whose
function is unknown, one could infer that B may share A's function. In the structural branch of
bioinformatics, homology is used to determine which parts of a protein are important in structure
formation and interaction with other proteins.    In  a technique called homology modeling, this
information is used to predict the structure of a protein once the structure of a homologous protein is
known. One example of this is the similar protein homology between hemoglobin in humans and the
hemoglobin in legumes (leghemoglobin). Both serve the same purpose of transporting oxygen in the
TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
348






Concepts of Bioinformatics
organism.   Though both of these proteins have completely different amino acid sequences, their protein structures are virtually identical, which reflects their near identical purposes.

16.  Molecular docking
























Fig. 13 Protein-ligand Docking

In  the  last  two  decades,  tens  of  thousands  of  protein  three-dimensional  structures  have  been
determined by X-ray crystallography and Protein nuclear magnetic resonance spectroscopy (protein
NMR). One central question for the biological scientist is whether it is practical to predict possible
protein-protein interactions only based on these 3D shapes, without doing protein-protein interaction
experiments.  A  variety  of  methods  have  been  developed  to  tackle  the  Protein-protein  docking
problem, though it seems that there is still much work to be done in this field. We are interested in
information about our DNA, proteins and the function of proteins. Genes and proteins can be
sequenced, so the sequence of bases in genes or amino acids in proteins can be determined. This
information must be stored in an intelligent fashion, so that scientists can solve problems quickly
and easily using all available information. Therefore, the information is stored in
databanks, many
of which are accessible to everyone on the internet. A few examples are a databank containing
protein   structures (the   PDB   or   Protein   Data   Bank),   a   databank   containing   protein sequences
and their function  (Swiss-Prot), a databank with information about enzymes   and their function
(ENZYME),  and  a  databank  with  nucleotide  sequences  of  all  genes  sequenced  up  to  date
(EMBL).



TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
349







Concepts of Bioinformatics


17.  Bioinformatics in Agriculture

The most critical tasks in bioinformatics involves the finding of genes in the DNA sequences of
various organisms, developing methods to predict the structure and function of newly discovered
proteins   and   structural   RNA   sequences,   clustering   protein   sequences   into   families   of   related
sequences, development of protein models,  aligning similar proteins and generating phylogenetic
trees to examine evolutionary relationships. The sequencing of the genomes of microbes, plants and
animals should have enormous benefits for the agricultural community. Computational analysis of
these sequence data generated by genome sequencing, proteomics and array-based technologies is
critically important. Bioinformatics tools can be used to search for the genes within these genomes
and to elucidate their functions.

The sequencing of the genomes of plants and animals should have enormous benefits for the agricultural community.   Bioinformatic   tools   can   be   used   to   search   for   the   genes   within   these genomes and to elucidate their  functions. This specific genetic knowledge could then be used to produce  stronger,  more  drought,  disease  and  insect  resistant  crops  and  improve  the  quality of livestock making them healthier, more disease resistant and more productive.
18.  Bioinformatics in India
Studies of IDC points out that India will be a potential star in bioscience field in the coming years after   considering   the   factors   like   bio-diversity,   human   resources,   infrastructure   facilities   and governments initiatives.
Bioinformatics   has   emerged   out   of   the   inputs   from   several   different   areas   such   as   biology, biochemistry,  biophysics, molecular biology, biostatics, and computer science. Specially designed algorithms and organized databases is the core of all informatics operations. The requirements for such an activity make heavy and high level demands on both the hardware and software capabilities. This sector is the quickest growing field in the country.   The vertical growth is because of the linkages between IT and biotechnology, spurred by the human genome project. The promising startups are already there in Bangalore, Hyderabad, Pune, Chennai, and Delhi. There are over 200 companies functioning in these places. IT majors such as Intel, IBM, Wipro are getting into this segment spurred by the promises in technological developments.




















TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
350






Concepts of Bioinformatics






































Fig. 14. Applications and Challenges in Bioinformatics














TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
351







Concepts of Bioinformatics


References

1.   Benson,D.A.,   Karsch-Mizrachi,I.,   Lipman,D.J.,   Ostell,J.,   Wheeler,D.L.(2005)   GenBank.
     
Nucleic Acids Research, 33, D34-D38.
2.   Bioinformatics in the 21st     century        (1998).   A   report   to   the   research   resources   and
Infrastructure    working    group    subcommittee    on    biotechnology    national    science    and Technology council white house office of science and technology policy Bioinformatics.
3.   Crick F. (1970). Central Dogma of Molecular Biology. Nature, 227, 561-563.
5.   Human genome project and beyond (ww.ornl.gov/hgmis/)
6.   Indigenous   knowledge,   Bioinformatics  and  Rural   Agriculture.                 (2005).    9th    ICABR
International Conference on Agricultural Biotechnology: ten years later , Ravello (Italy), July
6 to July 10.
7.   Jayaram B and Priyanka D. Bioinformatics for a better tomorrow. Department of chemistry
     
& Supercomputing facility for bioinformatics & computational biology, Indian Institute of
      Technology.
8.   Maglott  D.,  Ostell  J.,  Pruitt  K.  D.  and  Tatusova  T.       (2005)   Entrez   gene:   gene-centered
information at NCBI, Nucleic Acids Research, 33, D54-D58.
9.   Mcentyre J. and Ostell J. (2005). The NCBI Handbook. Bethesda (MD): National Library of
      Medicine (US)
10. McEntyre   Jo,   Jim   O.,   National   Center   for   Biotechnology   Information   Bethesda    (MD):
National Center for Biotechnology Information (US); 2002. The NCBI Handbook. Medicine (US), NCBI.
11. Ronald M. A., Knegtel, Irwin D. Kuntz and Oshiro C. M. (1997). Molecular Docking to
     
Ensembles of Protein Structures. Journal of Molecular. Biology. 266, 424-440
12. Wheeler,D.L.,   Benson,D.A.,   Bryant,S.,   Canese,K.,   Church,D.M.,   Edgar,R.,   Federhen,S.,
     
Helmberg,W.,   Kenton,D., Khovayko,O. et al.  (2005) Database resources of the National
     
Center for Biotechnology Information: Update. Nucleic Acid Research, 33, D39-D45.















TraiŶiŶg Prograŵŵe uŶder CAFT ͞OŶliŶe CoŶteŶt CreatioŶ aŶd MaŶageŵeŶt iŶ aŶ eLearŶiŶg EŶviroŶŵeŶt͟
352